PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.02G154000.1.p
Common NameGLYMA_02G154000, LOC100817274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 148aa    MW: 16682.7 Da    PI: 5.3462
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.02G154000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.21.6e-5534129297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy eplk yl+kyr
  Glyma.02G154000.1.p  34 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYSEPLKRYLHKYR 123
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+ege+
  Glyma.02G154000.1.p 124 EFEGER 129
                          ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-5329139IPR009072Histone-fold
SuperFamilySSF471137.45E-4136138IPR009072Histone-fold
PfamPF008084.9E-2839103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-206785No hitNo description
PROSITE patternPS0068507086IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-2086104No hitNo description
PRINTSPR006151.8E-20105123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGDNNIGKVL EREGFKYNFT AAASDTSAQD EVIKEQDRLL PIANVGRIMK QILPPNAKIS  60
KEAKETMQEC VSEFISFVTG EASDKCHKEK RKTVNGDDIC WALATLGFDD YSEPLKRYLH  120
KYREFEGERA NQNKGNNNTY ENNIANI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B6e-4533124192Transcription factor HapC (Eurofung)
4g91_B6e-4533124192Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.4030.0root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-116AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518964.11e-107PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822481e-61NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0R0KWV41e-107A0A0R0KWV4_SOYBN; Uncharacterized protein
STRINGGLYMA02G17310.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.19e-63nuclear factor Y, subunit B5